DPCstruct | MC13924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 86 ± 14 aa |
| Standard deviation of domain lengths | 13.74 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 49.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9V4A2 | 1-82 | MVRYYKIPVLLIEFSQDKSFSFQSASEIGDDVSPTNIISKLSLLVLHFPRLRIVWSRSLHATVEIFISLKTNQDEPDENRAM |
| A0A821P6J9 | 1-86 | MTRFYKKPMLLIEFDQKQAFHLANKQRYNSSSEFSSHDITSKLALLTMHFPKLKILWCPSPHTSAELFEDLKRDREEPDTKSAMLV |
| A0A6A6LCL5 | 662-731 | None |
| A0A817CIT1 | 359-471 | None |
| A0A3B5L1P1 | 725-794 | None |
| A0A2S2QTM6 | 27-111 | None |
| A0A0C9ZSC5 | 1-110 | None |
| A0A822C1L3 | 1-72 | None |
| A0A267F3H4 | 1-81 | None |
| A0A7S0FGV8 | 9-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.