DPCstruct | MC13922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 100 ± 15 aa |
| Standard deviation of domain lengths | 15.00 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 43.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00689 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8CDV1 | 1-103 | MHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRPQWENHHLQDLQDSYGQEWTFGQRLYQQYTC… |
| A0A821NPC4 | 1-103 | MKRRPRDPKHDRLVNERLISMAYGQIGMIQASAGFFVYLVIMAENGFWPSRLLGLRKSWESKGINDLEDSYGQEWTYNQRKTLEYTC… |
| A0A6I9YMN3 | 521-622 | None |
| A0A820CDV0 | 2-119 | None |
| A0A2A2KPX1 | 21-122 | None |
| A0A7R9AHP3 | 140-231 | None |
| A0A2G9S134 | 437-531 | None |
| A0A6G3MIE3 | 22-122 | None |
| A0A0B2UPR6 | 36-134 | None |
| A0A164VNA3 | 415-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.