DPCstruct | MC1392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 117 ± 20 aa |
| Standard deviation of domain lengths | 20.32 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 34.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D4Q3H9 | 4-107 | DESPVVGFAADGYPIFGPYINKGGQLRKALSSYRLKSGARPTGNGNPGGVYNGQYRDDYEYVAGLGDLDECNGMMHNGVYGYYITST… |
| A0A6P0XZF4 | 84-192 | ENAIVSPVIGFAADGFPIFGSYFDDNGTVRKAKSSYKLKEGDRQEVKGINPGGIYDGTYRDDYEYVAELGDLDECNGMTINGVYGYF… |
| A0A7W2CF00 | 3-91 | None |
| A0A848TNM2 | 173-287 | None |
| A0A2E9J422 | 264-402 | None |
| A0A1J5T9G0 | 267-375 | None |
| A0A2E5Y6B9 | 18-170 | None |
| A0A2V4E1G4 | 134-276 | None |
| A0A222FHV2 | 302-416 | None |
| A0A7M3YPD0 | 297-421 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.