DPCstruct | MC13919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 138 ± 17 aa |
| Standard deviation of domain lengths | 17.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820VJX6 | 151-261 | MSVNDYIQVIANSIEKYSINTFQNIILKHDDAYMIHLNQSGTCIDGYIKCHCKSAIKLPFRLNTKSFQLSHYFKHLKHSLCSMMKKK… |
| A0A821M591 | 4-125 | IIDTLNNWCENNKSKLNVQQFSLVEGEHYFILLQNDSNGALKCDIRCYCQKWSSLSLRRGKFQLSNFYRHLQGLNNICPALKKMISN… |
| A0A815TCB6 | 246-401 | None |
| A0A817H2K7 | 142-299 | None |
| A0A815KUR8 | 34-173 | None |
| A0A816WEL6 | 206-361 | None |
| A0A817LJY3 | 13-145 | None |
| A0A821R894 | 155-277 | None |
| A0A817JCV9 | 176-314 | None |
| A0A817MVI8 | 3-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.