DPCstruct | MC13918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 8.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2TYT4 | 74-146 | EESADAESADQLLEAFRVLSNGQPYVLAADLQRELSPELYEYCIANMSTYDDGPEGALDYSSFANALYGESDL |
| A0A821LIT6 | 1-76 | MTRECSEEDNVDQLTLAFKTLAGDQPFITAEALKRELPIEQAEWCLRRMKPYVGPGAIPGAYDYKIFSAALYGESD |
| A0A835TNV6 | 133-209 | None |
| A0A6B0RT99 | 50-122 | None |
| A0A5E4CJW8 | 142-209 | None |
| T1GQ10 | 223-287 | None |
| A0A6S7ILD5 | 201-275 | None |
| A0A0X3PEA9 | 744-810 | None |
| A0A5N5L0T0 | 760-834 | None |
| A0A820HZS5 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.