DPCstruct | MC13917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Standard deviation of domain lengths | 9.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821LGZ0 | 1-125 | MFYKSLPQVIDKLPMRVNLQRIASALELEFINPEMIPFVLPNMFLIAEKASNEEYQNYIFPKLKQVFKIQKPPQGSSASGSVMQTLL… |
| Q9NWE9 | 179-292 | FFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAEECTKEEYVKLILPELGPVFKQQEPIQILLIFLQKMDLLLT… |
| A0A1A9URR6 | 61-175 | None |
| A0A0N5AAP7 | 344-465 | None |
| A0A818CCT1 | 632-762 | None |
| A0A6A4VW24 | 9-102 | None |
| A0A7M4FP39 | 179-292 | None |
| A0A7R9KE38 | 1-127 | None |
| C3ZKK1 | 349-455 | None |
| D8PVX9 | 262-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.