DPCstruct | MC13916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 169 ± 22 aa |
| Standard deviation of domain lengths | 21.51 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 56.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7X1X4 | 1-166 | MFFNFLEQSFLPDLRAATMMDSPRALESDTALALNRYLCNAVLPLLSNHSHFFADAEHHAPLLDATLHTVYRMNRLRSLTKNQRDAV… |
| A0A6I9NPJ4 | 2-142 | ALALNRYLCSAVLPLLTKCAPLYAGTDHRAIMIDSMLHTIYRLSRGRALTKAQRDVIEECLVSLCKYLRPSMLQHLLRRLVFDVPIL… |
| A0A4U5NUX6 | 1-166 | None |
| A0A815S657 | 493-689 | None |
| A0A437DB53 | 69-269 | None |
| A0A1I7SG61 | 1-144 | None |
| A0A0N4YKW9 | 426-614 | None |
| A0A811WUZ6 | 425-570 | None |
| A0A6V7WKU3 | 1-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.