DPCstruct | MC13913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 103 ± 28 aa |
| Standard deviation of domain lengths | 27.54 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 53.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A137QBF5 | 150-222 | MFNSALEIAKFEGANIKTVSGIRGQVKKALPKPDDAFRATFEDKVLKSDLTFLRAWYSIEPRKFYKPVTLLLP |
| D7TUQ9 | 1-90 | MFTSDLEIARFESAGVQTASGIKGQVKETAKEELGNQPKKKRGLPREGIARCTFEDRILVSNLVLLRAWIEVEVPCFFNPLTTALQP… |
| A0A438GV60 | 76-226 | None |
| A0A6N2LU03 | 674-819 | None |
| A0A0D2LTC9 | 762-842 | None |
| A0A6N2LEQ5 | 131-259 | None |
| A0A7G2CHD3 | 1-87 | None |
| A0A6P5EUN7 | 812-900 | None |
| A0A7R9JWZ4 | 269-344 | None |
| A0A4P9YY49 | 241-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.