DPCstruct | MC1391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 4.70 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W5RIJ2 | 4-69 | RAKQTADEYRHLGGRRLAAFDDNKASTRAWDKDTPEAERFWQTRIAILPDRERAEVQSFLPSIVDE |
| A0A1N6WI97 | 6-71 | TPHQDLADQYLALGGRRQAIIDDNKVSVRQWDDEPQEADAFWRDNVDGLDDEGRREVALLLPSVSD |
| A0A5Q0CDI5 | 1-69 | None |
| A0A7J4VLF1 | 51-127 | None |
| A0A6G4WMP0 | 82-150 | None |
| A0A1W6Q3A2 | 50-118 | None |
| A0A1H6GUZ4 | 69-140 | None |
| A0A7Z8LJC5 | 52-126 | None |
| A0A7C9IXJ8 | 1-62 | None |
| A0A4R2ZGX2 | 80-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.