DPCstruct | MC13909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 193 ± 29 aa |
| Standard deviation of domain lengths | 28.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.67 |
| Pfam Score | 93.81 |
| Assigned Pfam label(s) | PF12009- CL0027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2QQL0 | 533-727 | EHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHQEARPALLTS… |
| A0A821KJP2 | 10-217 | WAKTSINSSSLISHLYICHLIHFLIRYVLILVRSYFYATEASSPCHQLALVFYRHKIWYVIQRQSRIELFHKSCSSHTEKDLTDNYD… |
| A0A834QA19 | 514-710 | None |
| A0A5D2V8Z4 | 44-261 | None |
| A0A177W7E2 | 69-315 | None |
| A0A0N0RSV1 | 86-248 | None |
| A0A2I0WT55 | 46-264 | None |
| A0A6P3RU56 | 1-162 | None |
| X6LY40 | 2-214 | None |
| A0A2S4UAD2 | 452-610 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.