DPCstruct | MC13907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 6.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498BDR7 | 2-78 | PTAEYEYKAAHKRVVQVKGPASHKPCQFCGTFAAEWSYNHQDPNEVYRDGYLWSENTAYYMPLCKRDHRAYDRAFRQ |
| A0A2S5USF5 | 49-142 | PRRGRPLDGEHPTFAAIHKRLTRTLGRASEHDCVDCGGPAREWSYNNADPDELTAEISGRTRGRFTVAYSLDISNYDPRCTSCHRKF… |
| A0A1H1V2H4 | 84-171 | None |
| A0A5C8HYJ6 | 27-100 | None |
| A0A7K2HN20 | 135-222 | None |
| A0A193BVN1 | 74-149 | None |
| A0A7I7MB68 | 14-101 | None |
| A0A4D4M091 | 2-82 | None |
| A0A059MRN7 | 21-101 | None |
| A0A259SF82 | 14-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.