DPCstruct | MC13906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 168 ± 20 aa |
| Standard deviation of domain lengths | 19.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9EZ70 | 30-227 | LAWGPSRQTYTMAQPADHVTFNSMTDNPREGDERAFFELKDAANTNSDGFAHQMTVKDGQEVLLRVYVHNNAADNLNGTNNSGVGVA… |
| A0A2S5UM62 | 5-144 | EQVWYDEMEIEPGAEYFVRAYLSLDGPADQVAKDVVLNFNLPDCTAHRIGVMATLSSDQTFPARIWDGAEFWSRDDFTLTVVPDSAQ… |
| A0A1X1XCY3 | 11-179 | None |
| A0A7G8A390 | 6-175 | None |
| A0A370CRC0 | 78-261 | None |
| A0A1F5K5T9 | 31-183 | None |
| R9JHP8 | 69-209 | None |
| A0A653YFF7 | 153-321 | None |
| A0A2N2BRW2 | 26-232 | None |
| A0A839N3V0 | 104-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.