DPCstruct | MC13904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 164 ± 18 aa |
| Standard deviation of domain lengths | 18.18 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04474 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A350EXV4 | 88-278 | QVWTGVRPSGVGAAFGLMGIALLATTIGRPLGRLLRVQAGMNRLGRWAGQMFTRAQEGGRVPFHDGFTACAILFCVGPLSVLGPVQE… |
| A0A7K0TV79 | 22-192 | VVVFSLLLGALIGNTMRIEDRLENFGTKLRNKFAHKGESNFVEGFVSASLIFAIGPLAILGSISDGMNTGIDQLILKSTLDFFAAMA… |
| A0A847CUB4 | 74-226 | None |
| A0A4P0YHB2 | 4-161 | None |
| A0A837RJX0 | 7-159 | None |
| A0A1I6QNU4 | 76-227 | None |
| A0A2D5MR13 | 185-340 | None |
| A0A2N2PUI5 | 133-319 | None |
| A0A7X8HQD5 | 2-155 | None |
| A0A1F1JVY5 | 7-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.