DPCstruct | MC13902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 5.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 49.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0378 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8KH70 | 44-109 | IVTYEDIKPYIDRIANGEPSNILLAESVLEFFRSSGTSGGQPKLIPVNAETLKLLAVSSALLTAVM |
| A0A811SMG9 | 1-70 | MATYDDLKPYNLRIANGDRSPILSGSVHPISEFNVSSHTSHGEPKLIPAVKDEVDRRMLLHGLVMAVMNQ |
| I1NS93 | 76-143 | None |
| A0A0D3C937 | 62-127 | None |
| A0A0D9XSM3 | 87-156 | None |
| A0A6J0NDD8 | 66-133 | None |
| A0A5D2Q6E9 | 29-90 | None |
| M1CC68 | 60-127 | None |
| A0A1U8HEI0 | 47-100 | None |
| A0A811SS73 | 496-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.