DPCstruct | MC13901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 164 ± 6 aa |
| Standard deviation of domain lengths | 6.37 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 81.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 71.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9HJC6 | 1-159 | MDLYVFATPYRVTWDYYFLSREHTLEIKEWQDKAEYEYVKNRGISIFLMQAGMLGTLEALWDVFPLFTNTGWGENSNIGFLEKHMGA… |
| A0A811SHP4 | 1-178 | MGGVCNGTGGGLGGGIVHVETSKAHSWTCIDLYVFATPYRVTWDYYFLGREHTLDFEEWESEAEYEYVKRNGVSIFLMPSGTIGTLR… |
| A0A6N2NHK4 | 113-277 | None |
| A0A2U1N000 | 102-270 | None |
| A0A7J7H8D1 | 1-150 | None |
| A0A830CIR2 | 1-159 | None |
| A0A446IZY1 | 1-159 | None |
| A0A7J7FQN6 | 67-235 | None |
| A0A6N2MPG8 | 518-686 | None |
| A0A444YEZ4 | 135-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.