DPCstruct | MC1390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 171 ± 15 aa |
| Standard deviation of domain lengths | 15.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850K3R9 | 304-467 | YFEKRRGNLKPKVIGVNFPLPAHIALLAKLGEEKSYSLEPIYKGRTNTLLATPMKRIEGAKPQYHELYLMVIKFGTRIQAVESKLSS… |
| A0A7G7FGQ4 | 3-160 | LFFGSGDSPSLEIALRTENNQHILEYWRDAKNRDMLASLFSATRMQALLPAAGELKETLIYCFTHSVRSHLYFFSATREELLQSGLM… |
| A0A4Q0YRM3 | 5-169 | None |
| A0A837NIN7 | 454-630 | None |
| A0A4V1LT10 | 70-237 | None |
| A0A6N8F6F3 | 485-656 | None |
| A0A090PK23 | 239-438 | None |
| A0A1T2L6M3 | 232-390 | None |
| A0A7Z0VM04 | 236-399 | None |
| A0A090P2V2 | 54-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.