DPCstruct | MC139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 140 ± 13 aa |
| Standard deviation of domain lengths | 12.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G8CEX4 | 1-155 | MKLVPTSECALRLIGSPLGQGMPQSELMLNRQSTGVIIDGAVLEVAIRWHDLLLVFVTDDIMHEDTLRIYLFDARLDLVDSAKLGWM… |
| A0A2S0MEC1 | 34-164 | MTPTQRYTLQQHEGPYAAWPLTSALRLDGQDTGQRVPGFVIDAQYDTPLGALLITSWDCLFEEANDFLLLGSTHRVVARKQLGAPYA… |
| A0A841HJZ8 | 1-133 | None |
| D0LH93 | 8-138 | None |
| A0A2W4M0R5 | 1-148 | None |
| A0A6L4B205 | 38-186 | None |
| W7DLY5 | 9-172 | None |
| Q2SC50 | 11-137 | None |
| A0A344UIX6 | 1-133 | None |
| L9PPG4 | 54-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.