DPCstruct | MC13899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 223 ± 33 aa |
| Standard deviation of domain lengths | 32.96 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849L0X2 | 21-278 | ANAPHQHAFVLLGSETIFAVHMTQYHHEEHKYQLVMKLALPAEAKSRLDDLRARFPADTFILSNGDAESDLFTIPDLPAGRRRSFNA… |
| F8P8Y2 | 611-845 | VVQGEDRLYLVYKACFNTASSRYQHVITGDIPITSKQEYLDNKRRIPFATFTARTLENIEITSFINKNSFSIEITSTSPTGTIAILE… |
| A0A2I2GMI9 | 704-959 | None |
| A0A2G0Z365 | 11-222 | None |
| A0A7W3R7G4 | 29-247 | None |
| I0WLZ1 | 105-357 | None |
| A0A420TXP0 | 1-223 | None |
| A0A5N6XMW1 | 243-480 | None |
| A0A1J9RPZ9 | 749-952 | None |
| A0A270QYN7 | 11-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.