DPCstruct | MC13897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 113 |
|---|---|
| Mean domain length (aa) | 96 ± 13 aa |
| Standard deviation of domain lengths | 12.61 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354H3L4 | 2-100 | ELMTREITHKAQEQYSLGSDMDNQFIVAKFFDPCGTWTWYLMNQDPDDSDYLWGIVNGNEIEVGSFSLSDLQNYKGSLGIGIERDLY… |
| A0A6L7X735 | 23-121 | HKLMTRELGDTIPALYANENEEDYDAVVAAAKLFSPYSGWRWYVTEWDRETGLCFGLVEGFEVELGYFDLSELSEVTVFGGVPAVER… |
| D3PV12 | 79-191 | None |
| A0A7R7BS07 | 1-94 | None |
| A0A7R7BGH5 | 9-112 | None |
| A0A7L4ZH56 | 36-131 | None |
| A0A381IBX4 | 175-257 | None |
| A0A7X1PG60 | 3-108 | None |
| A0A2N2KI32 | 38-128 | None |
| A0A497B1J3 | 241-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.