DPCstruct | MC1389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 169 ± 9 aa |
| Standard deviation of domain lengths | 8.71 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W6U5A1 | 4-162 | RLWTMKNKELELSRLRGILSGIATDAVINEQELLFLDAWLRERESQLENDGDAVDLLEQIADVLEDGVITKDEMEDTLNLIDCILEF… |
| A0A7G1L782 | 16-185 | AARNRDKQLNNLMGILDGIVADSAIDEQEMLYLDIWLKESASLNGWIFCELREMVADVLQDGQLCEAEKLHLMSALPRLMETYRHLP… |
| A0A410PU88 | 5-159 | None |
| B0TKS1 | 117-283 | None |
| A0A1G6S2W2 | 78-243 | None |
| A0A252F2K7 | 3-173 | None |
| A0A3D5LHM7 | 2-169 | None |
| A0A7Y8TSH3 | 188-347 | None |
| A6G9M5 | 7-165 | None |
| A0A2A5B8P8 | 11-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.