DPCstruct | MC13886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 117 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8NVG5 | 1-115 | MATVYEKLRDRLDMFPQGFAKTESGVELEVLQHLFAPEEAGIMLHLKPLPEKLSAIAQRIGKDEIELGKTLYDMSKRGLLNRYKAPD… |
| A0A7C5DL18 | 2-125 | NTLTDDQIYRNLQLHLDNFPIGFPATESGVEIEILKFFFTPLEAMIASCLNLAAKSPVKVQKRLTAKFQVEIPFDELASYLHKMFMN… |
| A0A0D2HKQ9 | 1-116 | None |
| A0A3N5FB00 | 1-117 | None |
| A0A524PYU3 | 5-115 | None |
| A0A1J4SQW8 | 1-112 | None |
| A0A4V1QU46 | 9-116 | None |
| A0A7C4ST17 | 389-506 | None |
| A0A2G9ZYS9 | 1-113 | None |
| A0A2N2M4S2 | 254-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.