DPCstruct | MC13883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 228 ± 36 aa |
| Standard deviation of domain lengths | 36.30 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J0YZZ5 | 1-194 | MSCKTPLKDDNNNGVGKDIEILNKISQRAINNFSVYARTKNTINSTEYQNKFDKLYTMVNKETESKKLNQMDEYVKNALATLKNGFI… |
| S5MH77 | 1-249 | MKKLLSLLATASLITTTTVSVVACGNKEKSGTKPPTESDQDLTALISDFKKDITLIKNEYWNQINKSFFSLVNVKQEIYQLLIKQKM… |
| A0A4D8RCY2 | 13-247 | None |
| A0A2K8SEC2 | 17-294 | None |
| A0A2K8SEA6 | 23-203 | None |
| A0A0H3XKN8 | 1-246 | None |
| A0A0H3XKN4 | 10-284 | None |
| W6A9F4 | 1-250 | None |
| W0GLV9 | 10-215 | None |
| A0A7Z7LCW2 | 1-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.