DPCstruct | MC1388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 240 ± 22 aa |
| Standard deviation of domain lengths | 22.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812GNA7 | 362-629 | KHHAKQIIAMKTRGQITGEYGNTEPVIAKAGVKPPESALSSLKDENAFMVELFLDRYPGQKIPNNSLISPREMYLKDMDLIEIQREK… |
| A0A7G1L2Z0 | 1-235 | MEGQPDILAKAGVKPPCSKDQHQNYMLDLYLNRTPGQKVDSEQLVSISEMWINECDLVSMTKTKTLNLEFDFKRKPMQPSMQSVLGI… |
| A0A090PR03 | 25-227 | None |
| A0A417BS18 | 79-300 | None |
| A0A1Y6D3Q0 | 25-261 | None |
| A0A2S8CG35 | 1-224 | None |
| A0A257DGL4 | 516-783 | None |
| A0A399HXI7 | 729-1010 | None |
| A0A415JSD8 | 714-934 | None |
| A0A7G7FF89 | 307-561 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.