DPCstruct | MC13879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 265 ± 43 aa |
| Standard deviation of domain lengths | 42.63 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 64.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.30 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | CL0010- CL0449 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182K675 | 1-198 | MATSESKIKFAFSSKPKGPLGKSPAANFVPKKNDGREKIECIENNTIKTSGASDGNETLEQRAAREIVEETAEAIVKKEEQGNFVVP… |
| A0A1Y1ZGN5 | 6-329 | MGGFKLSLGSKPVKSNALKTASTTLTKRPRAVLDEEEPEDNSTGPVEISGFDAAAGGALDVRGAKKEEEVRIINPLANRNWRAEAKR… |
| A0A0G2GR04 | 2-233 | None |
| A0A1E3PWG7 | 57-304 | None |
| A0A0H5BY51 | 1-227 | None |
| A0A1E3QVB6 | 6-271 | None |
| A0A2U1JCW5 | 2-231 | None |
| I7I8S8 | 3-279 | None |
| A0A6A5QHU0 | 1-294 | None |
| A0A0K0EE20 | 4-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.