DPCstruct | MC13877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 220 ± 26 aa |
| Standard deviation of domain lengths | 25.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9ZBE3 | 107-355 | EASMDAKTSKVLRRYELDKRQMDTWETSEEAVTIQVKTYARSIMGIAAFIVCGGMSVPFAVGSRIRGVDPFQITTFAWVLAGFLTIF… |
| A0A2P5HXN7 | 486-669 | RYESLREFTKLVDGWVVDEMSVTVPCPEYVWRVIAVASLLAGGGLGIGFSVGDRINGVDPSNLATYLWVVAAFIILIAKNMKVKEWA… |
| F0XNS3 | 135-356 | None |
| A0A1S9E1N5 | 846-1063 | None |
| N4V7D3 | 393-574 | None |
| C4JP91 | 518-763 | None |
| A0A4Q4W219 | 484-698 | None |
| A0A4R8Q6P6 | 227-408 | None |
| A0A139I7G3 | 567-802 | None |
| C7YJE4 | 523-758 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.