DPCstruct | MC13875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 212 |
|---|---|
| Mean domain length (aa) | 144 ± 29 aa |
| Standard deviation of domain lengths | 28.61 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 31.40 |
| Pfam Score | 96.22 |
| Assigned Pfam label(s) | PF16639- PF00223- PF05695- CL0304- PF00329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1FDI5 | 1-107 | MREMDVAFVEGAIASEAQVAKLQQIRTLAKKLVAIGACAVVGMPSAQRNNFDEATKAEIAPFLLQFHHADKIRTIADIVTVDDRVPG… |
| X1RAC4 | 3-129 | LKFLIASLTSCTGCISALISLDIFPQFLERTKIEYFPFISDNLKINECDIALVEGCVSEKNQIEYLQEIRKNAKKLYALGTCSAFGG… |
| A0A7K0PZN7 | 1-104 | None |
| G4TH23 | 6-138 | None |
| L0HK62 | 66-186 | None |
| A0A101G1K4 | 39-217 | None |
| A0A4T0J692 | 96-252 | None |
| A0A7V4JRC2 | 76-255 | None |
| L0AJC7 | 27-209 | None |
| A0A521S0D4 | 15-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.