DPCstruct | MC13873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 169 ± 17 aa |
| Standard deviation of domain lengths | 16.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1QXT9 | 12-218 | NIWKALNFAEKIISAIDQAFSDIAKVNSTSEMVKRYTDDWWKIDNEYKSFRLKTDSDDQLQTLSRCVRTMYRDYQNQLNEKFLNLIS… |
| A0A1V5BLP3 | 32-193 | YYKLDGSYRHFLLSYDKLAEQDGFIPLFEKVENCYTNWYLNELSMKWCAFLDDGTAWQVPGVTPQQGFYEKYVRRFVSDNERLVVII… |
| X0QF85 | 201-395 | None |
| A0A3A9BQJ3 | 378-534 | None |
| A0A379V0U4 | 79-245 | None |
| A0A433UFB4 | 27-187 | None |
| A0A1X1QJZ7 | 1-151 | None |
| A0A3R7FDX3 | 24-185 | None |
| A0A7C6KAW2 | 9-169 | None |
| A0A7H4M154 | 324-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.