DPCstruct | MC13872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 7.25 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.21 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF01300- PF07503 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0F1M3 | 38-125 | MAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPHLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLR |
| X1QQU2 | 1-92 | MNVFKMCPQCQSEYENIEDRRYHAQPNACADCGPQVSLYQNKKRLENIDPIEEAVELLKKGKIGAIKGLGGFHLACDATNNKVVARL… |
| A0A379WN65 | 58-139 | None |
| A0A7I9W1N9 | 148-236 | None |
| C0QPN6 | 139-235 | None |
| A0A2Z5JTV2 | 159-250 | None |
| A0A370DVN0 | 151-247 | None |
| A0A381GGR9 | 112-202 | None |
| A6FYA9 | 129-232 | None |
| A0A2N1T0D4 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.