DPCstruct | MC1387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 110 ± 11 aa |
| Standard deviation of domain lengths | 10.61 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 42.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225VR54 | 157-245 | IYSLGIMPWVPTTADWCAEALEPDRQEALRVGWLNCPESHPYNTVFVPCNSMVPLFLPSGYTMETVGPAIIPDSSVNPADSDPSWNI… |
| G5AIP5 | 6-104 | VLQYSFENLTWAPRSDEWVSECLELDGHQPWRNCWVDVPSEHPYNTTCAPCNPRVPLFVPRGMTVREVATAITVNPMLDPRRVTAPW… |
| A0A225V4B9 | 11-124 | None |
| A0A225VCK9 | 386-484 | None |
| A0A225VDA2 | 190-297 | None |
| A0A6A3KAS0 | 365-472 | None |
| A0A225W8S3 | 279-394 | None |
| A0A6A3YVQ6 | 299-414 | None |
| A0A6G0JDQ4 | 3-119 | None |
| H3H7E4 | 30-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.