DPCstruct | MC13869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 279 ± 56 aa |
| Standard deviation of domain lengths | 56.28 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1K0GB34 | 32-338 | AAVWWFAQHLRRDEEPGPARRAPLSAAAAMATAAIVLFILTPEADRFGKQAHGWWIVYAIAWIGYGATTAVAAAAIFWRTARSMRSP… |
| A0A2S6AKQ4 | 36-308 | AAVMGILFFLAPVHDEVHAIDFDDHYATEPMVVAFLLVYLSAFGWANIRLFLMCRTWLPHARHHFWLRCGLILITVGSLLAGGGYAG… |
| A0A164JHB7 | 57-382 | None |
| A0A2N0GR45 | 251-572 | None |
| L1KXV8 | 73-297 | None |
| A0A511MBL6 | 3-332 | None |
| Q4A4B4 | 16-287 | None |
| A0A7H5K7W0 | 86-401 | None |
| X8DSF4 | 2-230 | None |
| A0A2D3U794 | 33-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.