DPCstruct | MC13867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 7.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J1ZFF1 | 21-111 | PAASAQPTPDWNTFYDKTANFVAPFDPGAFGDKGDRALVLSPYGTGRVIECKGDGHYVAVYCRQFDDQGREHALTQVISTPFRGVYV… |
| A0A2S6A0D6 | 3-79 | DPANYSLQNDNFVAYNDPAALSAKDNGKQVIVSPYGTSKPIACHDNTAPLDDCWQRDDFGWFQLQKQELPQIGIAWV |
| A0A3M2L8F3 | 15-116 | None |
| K8Y2E1 | 38-129 | None |
| A0A846YI52 | 86-177 | None |
| A0A3A4KV09 | 138-217 | None |
| A0A173LJD4 | 66-156 | None |
| A0A2A3GP36 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.