DPCstruct | MC13865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 117 ± 18 aa |
| Standard deviation of domain lengths | 18.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 18.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6AUG8 | 6-98 | CLDDASFSKLYNKIKKTNFDDNKFDLIEVASLGCYYSCAQVVRIMKIFSFDDSKIKVLSMMAPRIVNLQNATDIYRIFTFDSDKEKA… |
| A0A3M1TMH7 | 12-131 | AAVTTTATEVEAVDAAPAAGAEPAAGAYGMPPADFERLLAAIRDEDFADGKRRVVEDSAESWTFTCKQVASILELFTFGDDKLAALR… |
| A0A2W2B3K7 | 243-369 | None |
| A0A3D1QWR4 | 200-318 | None |
| A0A2N5YW63 | 21-119 | None |
| A0A2N2LDY0 | 126-248 | None |
| F4Q2N3 | 1-92 | None |
| A0A7R9YCP2 | 3-99 | None |
| A0A813B9M6 | 60-196 | None |
| S4RN52 | 12-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.