DPCstruct | MC13864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 156 ± 22 aa |
| Standard deviation of domain lengths | 21.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 21.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4XPM7 | 202-323 | QFTINKSLDSIEYQAPQDILEMHKSLNRTRVAMEDHTTATCDAYMCVVLNEGKHSVYIAFFLVDSGRTMVFTPDVPPGSTDSYQKIF… |
| A0A3M1TBE7 | 1-167 | MFQPNPTLTHIGADRSQVVSIIESINHPHIGVPGFDPQVTQAYVVGVRVPTGLFQIYVYLYLTEDRRAVIYTYSGGAVDLEHYPEVE… |
| Q39XF1 | 1-187 | None |
| A0A7V4YS35 | 3-191 | None |
| A0A2E5HN31 | 1-158 | None |
| A0A2N6ELU4 | 1-153 | None |
| A0A2T5R8X0 | 2-188 | None |
| A0A2N6FGV6 | 434-556 | None |
| A0A3D1QS14 | 1-145 | None |
| A0A2J6JDF8 | 164-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.