DPCstruct | MC13861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 190 ± 15 aa |
| Standard deviation of domain lengths | 15.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1Y2T8 | 1-194 | MVPFNSRARASTGRGADSVLDQLARDLSERRATGSDIERAEFREIKVNLDAQRLLDTLSRAHGLIVDKYAITKGADGGDRIRAGTRN… |
| A0A737EXE2 | 469-657 | EYSFAELSVKNTSKAADNVVESLRVNIIDSAMTIKEMDKEKWKLIHRHINVQSFLKALEHTHGLSSEKYSVSKAKDGADRIRCGNRN… |
| W4SMB1 | 21-213 | None |
| A0A4C4K6F9 | 183-390 | None |
| A0A4Y9S9V0 | 330-557 | None |
| F9S7K5 | 401-579 | None |
| Q5I738 | 141-329 | None |
| A0A242M958 | 201-402 | None |
| A0A1Y0FMU9 | 605-798 | None |
| A0A4R6EK55 | 144-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.