DPCstruct | MC1386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 202 ± 19 aa |
| Standard deviation of domain lengths | 19.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6VLI7 | 273-454 | DTQSLIDAYKHMNDQILLNERAVEESSSHVHALVGYSPTAATDFRRQVNELQASIGAEKTKRDVRVAALIAHVWKPRCEEFKSLFDT… |
| G5AH98 | 31-236 | EPSAEPVQEYELKMPPGLALLIDAYNQVNDQVLSKQKDEKKVETEMESTADMEEKTTDTELQSRLHKLRESIKLEKEKRDAAVAAVI… |
| A0A6A3S1J1 | 1-174 | None |
| A0A0W8CQW7 | 20-205 | None |
| D0N2B6 | 289-493 | None |
| A0A662XAP0 | 98-311 | None |
| A0A6G0WHE2 | 221-468 | None |
| H3GHS8 | 384-556 | None |
| A0A225W9C6 | 507-703 | None |
| A0A6A4G0T3 | 1-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.