DPCstruct | MC13859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 128 ± 19 aa |
| Standard deviation of domain lengths | 18.78 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 29.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R5GWZ2 | 9-131 | GAVTSLVASLVATVSAAQAGCECLTELPLALRQSDLYDEAEGCLYYENAGVRYCYNISYGLNECAAHDEGLDPFCSSFFPPDFCEQS… |
| A0A812VH79 | 87-187 | GKKSCRCVGYDGTPGTVNVTIDKKELKYPADTGATCESWDAKRHPDCAGDKPAGWCKQEWCYVDPCECDLDVPPKTSSYLPSGMVNG… |
| A0A7S2L4T8 | 5-135 | None |
| R1CX02 | 2-116 | None |
| R1D6R4 | 77-181 | None |
| C1N5P2 | 50-198 | None |
| A0A7S1NWP8 | 17-159 | None |
| R1F631 | 10-102 | None |
| R1DLN8 | 7-125 | None |
| A0A7S4NEA8 | 31-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.