DPCstruct | MC13858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 3.62 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 53.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D2KHP5 | 123-193 | LQGGKSRKRLTTLVWQATIYWLWHERNGRLHLQIFMSEDSLLGQIDRQIKNRIASYRDGNTILASNLLQLW |
| A0A3P6B3S7 | 13-74 | LSHLAWQALVYWIWNERNARLHSNTFRSVDTIYNFIYRQLKNKIQSFRTSNPTLSSQMMQVW |
| A0A3P6C670 | 273-336 | None |
| A0A3P6C511 | 521-591 | None |
| A0A078HV09 | 85-147 | None |
| A0A0D3BPY1 | 373-437 | None |
| A0A3P6C9B1 | 294-357 | None |
| A0A0D3CPA3 | 2-63 | None |
| A0A0D3B681 | 214-275 | None |
| A0A816KA77 | 3-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.