DPCstruct | MC13857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 270 ± 29 aa |
| Standard deviation of domain lengths | 29.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1YDR0 | 2-285 | LLTTVGLLLSTRNVFGRFDESYLEFENMSYLLGITVVVLDIQLILQMMRRDARDDSNGDEVGLQETISPNGRCGVIDDATVHVYGAT… |
| A0A7S3BTZ7 | 2-235 | HGVGVSAINIAGAYSESYSVWAVGVAAVLGASSAIGGGLELATGRVPDDDRPGFAHERAILLYTSSYLPSTLWLSLRFSPLYPVALA… |
| A0A2R5GIH9 | 1-225 | None |
| A0A812I4W4 | 154-446 | None |
| A0A7S2YDL5 | 1-284 | None |
| R1BAQ0 | 3-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.