DPCstruct | MC13856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 174 ± 34 aa |
| Standard deviation of domain lengths | 33.50 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812MA00 | 8-150 | NADGLAAEWEAEAVIRERVRTGHNFVAAVNDQNLDACNKLAIRNCDVMTPVLVRMTACSLKLPDIDPLRGAVRALYLMASREISDSH… |
| A0A812NEF4 | 2-138 | EYDGLVKEWDACESIRNRLRGGGFLEDTSLGDEPNNKVCVLNQDVIVPLLVRMVPVNLQLPIVEQLRTVVAKLYEDNQRQVDESRVD… |
| A0A812UST7 | 8-173 | None |
| A0A812V061 | 1-181 | None |
| A0A812R5Y8 | 25-146 | None |
| A0A812RDF1 | 13-139 | None |
| A0A812JEW3 | 6-200 | None |
| A0A1Q9ECE2 | 2-221 | None |
| A0A1Q9ED06 | 1-149 | None |
| A0A812N5J6 | 4-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.