DPCstruct | MC13853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 151 ± 20 aa |
| Standard deviation of domain lengths | 20.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7CVS7 | 1-153 | MSLLGLVDRLLLKRPVTFLGRDDQYLLRDGTRGKGGFEKIGKDYEAPPLCLRDYLSYDEMKLSALLSVSSASFFVNDGSRKNQGVPG… |
| A0A7S3ATF0 | 175-298 | KLITRMLSKRPLAFLDADDQFALATGERGVGKDLFPRIGTSSERAPLVLKDYLSYDEMEVAALLGVAVPTFLINDGARGNRAMPGGP… |
| A0A0N1PF66 | 119-298 | None |
| A0A1Y2TEP4 | 87-217 | None |
| A0A3R7MBW7 | 249-409 | None |
| A0A7T9BW73 | 21-178 | None |
| A0A431IIJ1 | 134-310 | None |
| A0A2I0RZY4 | 309-416 | None |
| U4U3X8 | 110-249 | None |
| A0A0P4WIX0 | 1-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.