DPCstruct | MC13852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 776 ± 100 aa |
| Standard deviation of domain lengths | 99.60 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812K2V9 | 2-686 | SSRKSTYEAVVFCRYALGVEELDLCVKSRRCLGSACHGEVRPKNRAAPLTVAELGILHDRLENAPDAWDRVFSGAVLLCTYMRARWS… |
| A0A813AU43 | 7-714 | QRWAKRLRAIAERAGAYADPDRSASPDGILSDEEKARLQLLVFTSGAPSTMANHIRRFEKFERWAQRVGIDFYPLSDDKILKYAIDL… |
| A0A812S1T4 | 274-1059 | None |
| A0A1Q9EN39 | 111-785 | None |
| A0A812Y8D1 | 13-799 | None |
| A0A812YBZ6 | 23-771 | None |
| A0A813ACE8 | 3-575 | None |
| A0A1Q9DMH6 | 105-933 | None |
| A0A1Q9C4D6 | 335-1128 | None |
| A0A1Q9C8N3 | 318-985 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.