DPCstruct | MC13851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 160 |
|---|---|
| Mean domain length (aa) | 215 ± 47 aa |
| Standard deviation of domain lengths | 46.64 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.67 |
| Pfam Score | 91.06 |
| Assigned Pfam label(s) | CL0039- CL0733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9Q857 | 3-204 | VLDPIKLIITNYEKGTEDLTGENNPEAEDGGGTRVIPFSNELWIEREDFMEVPAKKWFRLAPGAMVRLKFAYIVKCEDFVKDENGNV… |
| A0A812IVG5 | 299-549 | MRRRGFTAASIRNFCESVGVSRSEGVVDMGMLEHAIREDLDRTAPRAMCVLNPLKVTLTNIEAGQVQLLDMANHPKDESMGRREVPF… |
| A0A258VBS5 | 9-238 | None |
| A0A0B8P2D4 | 4-180 | None |
| A0A485JLE9 | 82-222 | None |
| H0EQH4 | 104-320 | None |
| A0A167KSB0 | 13-225 | None |
| A0A151HCF9 | 522-802 | None |
| A0A6P5FQG2 | 18-246 | None |
| A0A812IRP9 | 288-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.