DPCstruct | MC1385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 357 ± 61 aa |
| Standard deviation of domain lengths | 61.19 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.46 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0536- CL0360 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7WVY0 | 28-434 | EYYLRNKQNRTKTLFRNLSASELEQLVRNHNQADNWNNILVSDAFNPDLVKNCKFFGLIRIGKLEPFFLEYHNLRMPVGLYNSTIIS… |
| G5AEJ0 | 1-354 | MPQHAQTHDLAALLASDHVQYVKARREDFTRSYFPLSAAEIRALEANGNTADDWRDVRKTHEHAPLQTASIRQCSFHGRVALGSFSA… |
| A0A024FUA6 | 1-443 | None |
| A0A482SK99 | 183-509 | None |
| A0A6L4ZA33 | 15-328 | None |
| A0A397F0E4 | 1-372 | None |
| A0A6N2EA68 | 109-573 | None |
| V5WCM9 | 1-360 | None |
| A0A7S3QA94 | 72-514 | None |
| A0A418F1A2 | 17-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.