DPCstruct | MC13846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 177 ± 47 aa |
| Standard deviation of domain lengths | 47.01 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 83.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850CWV2 | 1-114 | LLAHGLRIAAPCPHERPCPATWCHFGTRLPRTELHRILKHGTRNFEDEKFTYVVATRNPVDPPRARVIARPLHPKNRVVLDLCTESG… |
| A0A1Q9F5J4 | 8-177 | VLVLVEPGTPTGFRFMHHTREMLINRVGPDNFHFVAPCPHEGMCPLALTGRDWCHFAQRVRRTPHRVYCKGSTRRFMEEEKFSFLCI… |
| A0A7J7IPM8 | 65-290 | None |
| A0A545VG00 | 655-913 | None |
| D0N208 | 258-409 | None |
| A0A5J4Z6W8 | 277-452 | None |
| A0A0M3II03 | 177-306 | None |
| A0A177W9X4 | 269-466 | None |
| A0A7R9AAV5 | 631-822 | None |
| A0A7L5XWX9 | 3-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.