DPCstruct | MC13843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 4.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 69.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.91 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 63.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19690 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H5DPI4 | 1-64 | MFNVFEELFAPGRKHTRDEENRLELTREDVGDNDPGRGPIDLASGKAVIRLPEPPPAAAEPEAE |
| A0A239H250 | 1-52 | MFNALDELFAPGRRHAEDERNRLELVRDEEGDADPGRGPVDLDSGAVLIRPP |
| A0A4S2UQ68 | 1-64 | None |
| A0A7K3RQM3 | 1-60 | None |
| A0A2N0GTE5 | 6-68 | None |
| A0A5D4J359 | 1-64 | None |
| A0A6I5CLL6 | 1-54 | None |
| B5HDX6 | 1-62 | None |
| A0A4Y3RMC9 | 7-70 | None |
| A0A6H1JES8 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.