DPCstruct | MC13842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 9.97 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H8LPW2 | 1-73 | MKIELTDDQALVLSDWMSRVMHRAEFSAVVDDRAVWSALFKINGTLETQLSSIFDSSYSDQLAAARRRLISEL |
| A0A1H5DA78 | 1-89 | MDDEAISIKLTHDQALVLSDWLYQVMFQSDDLAGIVRERAVWSPIYAISGTLDKALTEIFRPDYASRLEASKERLHTQMYGETNEST… |
| A0A7H0NMP4 | 57-124 | None |
| A0A3D9M5L6 | 1-84 | None |
| A0A2G1X9S9 | 1-90 | None |
| A0A1T4KHN5 | 43-113 | None |
| A0A810MD07 | 1-101 | None |
| A0A1H5GCW3 | 115-202 | None |
| A0A1C6U8U2 | 28-112 | None |
| A0A6I5H6V4 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.