DPCstruct | MC13841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 99 ± 15 aa |
| Standard deviation of domain lengths | 14.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13397 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A841ILT8 | 5-96 | ERGEAAPRVRVPFYCANLHEVVPSFASEALVPDEWDCPRCGFPAGKDKANPPSPPRTEPYKTHLAYVKERRSEEEGKLILDEALAKL… |
| A0A318M384 | 5-96 | TDLAARVTARFACARGHGFTVQFAADAEVPASWICRQHGVEGSRRIDATENTPAAAKGKPARTPLVLLYERRSEAELEALLADTLMA… |
| A0A3P3VXF4 | 4-115 | None |
| A0A6L6D336 | 7-118 | None |
| A0A1Z2LAB6 | 1-83 | None |
| A0A1G6UI31 | 2-83 | None |
| A0A841EMJ1 | 6-114 | None |
| X8FC60 | 1-68 | None |
| A8L885 | 103-209 | None |
| A0A852R5D8 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.