DPCstruct | MC1384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 11.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5A880 | 5-131 | FDSARGPPENTYTSHFLETQSADEDSRPLQLGSINILCTSGMQAHEFAAVCSAMAVAQTTKSVSLRLENFPRRNMPSTHWWKWVAYA… |
| G4YPY7 | 173-296 | YHRKFETPEARPLQMGTVRLICASWLESREVEATGSAIAVCRNARKLSMRLEMHSTDVDITRQWWRWIAYALFSKRARTSSSVESLA… |
| A0A6A3RBQ1 | 195-317 | None |
| A0A6A3KFJ4 | 105-222 | None |
| A0A0W8CMQ6 | 3-124 | None |
| A0A6G0QQT5 | 73-204 | None |
| A0A6G0RQ75 | 8-124 | None |
| W2PNA6 | 133-234 | None |
| A0A225WYF8 | 125-239 | None |
| A0A6G0KIY3 | 195-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.