DPCstruct | MC13839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 161 ± 15 aa |
| Standard deviation of domain lengths | 14.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D9AK08 | 2-188 | STLWKITVMEKKDDYIDLLVKFSHPDAGPFPQDKNFALQLLINEAYGFDENFNRYPNSPLGKAISPDKFQPDDLDDLVDSYIKDTII… |
| A0A2M9B3K2 | 2-146 | TDLYGVRVLAVDPPRRRIRLRSTVVYYDSGSHAPLTDDASFFLRVLGESADGAPLGDAVTQDQRLDEVWVDANTRWFVESVERVATR… |
| A9V444 | 3-162 | None |
| A0A1Q5LJJ3 | 2-153 | None |
| A0A5N8X464 | 1-168 | None |
| A0A142XNU9 | 1-202 | None |
| A0A286DSF6 | 1-166 | None |
| A0A067C7B0 | 1-154 | None |
| A0A519NL03 | 2-157 | None |
| A0A1H5Y3Q1 | 2-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.