DPCstruct | MC13838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 136 ± 14 aa |
| Standard deviation of domain lengths | 13.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.30 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF10635- CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X0KD52 | 219-352 | DELLGGNDIARELTVRDYHASPEPLSKAQMTATLDELDALSDTELLELTALAKVFGYPTTAEAQDSAVSPRGYRALASIPRLQFAHS… |
| A0A4V1S3I5 | 28-162 | DELVANVEDEGLLIIQDYATTLGEKTPESILKVIGSWPAEDLLDLVLIARALGYPGSASVLDQGVHPKGFRVLKKIPRLPVPVIENL… |
| A0A357ZD59 | 2-172 | None |
| A0A7C3T4P0 | 129-252 | None |
| H1D561 | 131-284 | None |
| A0A2G6DTX6 | 96-229 | None |
| A0A7Y1VPC2 | 2-115 | None |
| W4U870 | 77-210 | None |
| A0A852QMS6 | 184-320 | None |
| A0A7K3CWW6 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.